P2RX2 anticorps (N-Term)
-
- Antigène Voir toutes P2RX2 Anticorps
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp P2RX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- P2 RX2 antibody was raised against the N terminal of P2 X2
- Purification
- Affinity purified
- Immunogène
- P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
- Top Product
- Discover our top product P2RX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
P2RX2 Blocking Peptide, catalog no. 33R-5584, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
- Autre désignation
- P2RX2 (P2RX2 Produits)
- Synonymes
- anticorps DFNA41, anticorps P2X2, anticorps P2X2a, anticorps P2x2, anticorps p2xr2, anticorps P2RX2, anticorps purinergic receptor P2X 2, anticorps purinergic receptor P2X, ligand-gated ion channel, 2, anticorps P2RX2, anticorps P2rx2, anticorps p2rx2
- Sujet
- The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity
-