CLCNKB anticorps (N-Term)

N° du produit ABIN633631

Détail du produit anti-CLCNKB anticorps

Antigène: CLCNKB (Chloride Channel Kb (CLCNKB))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCNKB est non-conjugé

Application: Western Blotting (WB)

Specificité: CLCNKB antibody was raised against the N terminal of CLCNKB

Purification: Affinity purified

Immunogène: CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLCNKB Blocking Peptide, catalog no. 33R-5901, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLCNKB

Antigène: CLCNKB (Chloride Channel Kb (CLCNKB))

Autre désignation: CLCNKB (CLCNKB Produits)

Synonymes: anticorps CLCNKA, anticorps CLCNKB, anticorps DKFZp469N0132, anticorps CLCKB, anticorps Clc-Ka, anticorps Clck2, anticorps Clcnk1l, anticorps ClC-K2L, anticorps ClC-K2, anticorps ClC-Kb, anticorps ClC-k, anticorps clc-kb, anticorps clckb, anticorps clcnka-A, anticorps clk-k2, anticorps x6clck, anticorps xCIC-K, anticorps xClC-K, anticorps zgc:64141, anticorps Clcnkb, anticorps chloride voltage-gated channel Kb, anticorps chloride channel Kb, anticorps chloride channel, voltage-sensitive Kb, anticorps chloride channel, voltage-sensitive Kb L homeolog, anticorps chloride channel K, anticorps chloride channel protein ClC-Ka, anticorps chloride channel protein ClC-Kb, anticorps CLCNKB, anticorps Clcnkb, anticorps clcnkb.L, anticorps clcnk, anticorps LOC100017912, anticorps LOC100400180, anticorps LOC100590605, anticorps LOC100730738

Sujet: Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Poids moléculaire: 50 kDa (MW of target protein)