SHROOM2 anticorps (Middle Region)
-
- Antigène Voir toutes SHROOM2 Anticorps
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHROOM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SHROOM2 antibody was raised against the middle region of SHROOM2
- Purification
- Affinity purified
- Immunogène
- SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
- Top Product
- Discover our top product SHROOM2 Anticorps primaire
-
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibody
SHROOM2 Reactivité: Humain WB, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 1554-1616) antibodySHROOM2 Reactivité: Humain WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 213-405) antibodySHROOM2 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 599-625) antibodySHROOM2 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37634 unconjugated
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibodyVerified SHROOM2 Reactivité: Humain ELISA, IHC Hôte: Chèvre Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 1295-1344) antibodySHROOM2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Poulet, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
- Autre désignation
- SHROOM2 (SHROOM2 Produits)
- Synonymes
- anticorps SHROOM2, anticorps APXL, anticorps apxl, anticorps shrm2, anticorps HSAPXL, anticorps 4832440C16, anticorps Apxl, anticorps C630003H05Rik, anticorps Shrm2, anticorps shroom family member 2, anticorps SHROOM2, anticorps shroom2, anticorps Shroom2
- Sujet
- SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
- Poids moléculaire
- 176 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Asymmetric Protein Localization
-
