KCTD7 anticorps (N-Term)

N° du produit ABIN633658

Détail du produit anti-KCTD7 anticorps

Antigène: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD7 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCTD7 antibody was raised against the N terminal of KCTD7

Purification: Affinity purified

Immunogène: KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD7 Blocking Peptide, catalog no. 33R-9904, is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD7

Antigène: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Autre désignation: KCTD7 (KCTD7 Produits)

Synonymes: anticorps 4932409E18, anticorps 9430010P06Rik, anticorps zgc:136884, anticorps CLN14, anticorps EPM3, anticorps potassium channel tetramerization domain containing 7, anticorps potassium channel tetramerisation domain containing 7, anticorps KCTD7, anticorps Kctd7, anticorps kctd7

Sujet: The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.

Poids moléculaire: 33 kDa (MW of target protein)