ACCN4 anticorps (N-Term)

N° du produit ABIN633663

Détail du produit anti-ACCN4 anticorps

Antigène: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACCN4 antibody was raised against the N terminal of ACCN4

Purification: Affinity purified

Immunogène: ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN4 Blocking Peptide, catalog no. 33R-8696, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACCN4

Antigène: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Autre désignation: ACCN4 (ACCN4 Produits)

Sujet: ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

Poids moléculaire: 46 kDa (MW of target protein)