KCTD4 anticorps (N-Term)

N° du produit ABIN633664

Détail du produit anti-KCTD4 anticorps

Antigène: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCTD4 antibody was raised against the N terminal of KCTD4

Purification: Affinity purified

Immunogène: KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD4 Blocking Peptide, catalog no. 33R-6554, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD4

Antigène: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Autre désignation: KCTD4 (KCTD4 Produits)

Synonymes: anticorps bA321C24.3, anticorps 2210017A09Rik, anticorps AU017169, anticorps wu:fk37b10, anticorps zgc:92463, anticorps potassium channel tetramerization domain containing 4, anticorps potassium channel tetramerisation domain containing 4, anticorps KCTD4, anticorps Kctd4, anticorps kctd4

Sujet: KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Poids moléculaire: 30 kDa (MW of target protein)