KCNV1 anticorps (N-Term)
-
- Antigène Voir toutes KCNV1 Anticorps
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNV1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNV1 antibody was raised against the N terminal of KCNV1
- Purification
- Affinity purified
- Immunogène
- KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP
- Top Product
- Discover our top product KCNV1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
- Autre désignation
- KCNV1 (KCNV1 Produits)
- Synonymes
- anticorps HNKA, anticorps KCNB3, anticorps KV2.3, anticorps KV8.1, anticorps 2700023A03Rik, anticorps vibe, anticorps Kv8.1, anticorps potassium voltage-gated channel modifier subfamily V member 1, anticorps potassium channel, subfamily V, member 1, anticorps KCNV1, anticorps Kcnv1
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.
- Poids moléculaire
- 56 kDa (MW of target protein)
-