KCNK12 anticorps (Middle Region)
-
- Antigène Voir toutes KCNK12 Anticorps
- KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNK12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNK12 antibody was raised against the middle region of KCNK12
- Purification
- Affinity purified
- Immunogène
- KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF
- Top Product
- Discover our top product KCNK12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))
- Autre désignation
- KCNK12 (KCNK12 Produits)
- Synonymes
- anticorps KCNK12, anticorps K2p12.1, anticorps THIK-2, anticorps THIK2, anticorps mntk1, anticorps potassium two pore domain channel subfamily K member 12, anticorps potassium channel, subfamily K, member 12, anticorps KCNK12, anticorps Kcnk12
- Sujet
- KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Poids moléculaire
- 47 kDa (MW of target protein)
-