KCNJ5 anticorps (N-Term)

N° du produit ABIN633707

Détail du produit anti-KCNJ5 anticorps

Antigène: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNJ5 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNJ5 antibody was raised against the N terminal of KCNJ5

Purification: Affinity purified

Immunogène: KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNJ5 Blocking Peptide, catalog no. 33R-1190, is also available for use as a blocking control in assays to test for specificity of this KCNJ5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNJ5

Antigène: KCNJ5 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5))

Autre désignation: KCNJ5 (KCNJ5 Produits)

Synonymes: anticorps CIR, anticorps GIRK4, anticorps KATP1, anticorps KIR3.4, anticorps LQT13, anticorps Kir3.4, anticorps GIRK-4, anticorps KATP-1, anticorps potassium voltage-gated channel subfamily J member 5, anticorps potassium inwardly-rectifying channel, subfamily J, member 5, anticorps KCNJ5, anticorps Kcnj5

Sujet: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ5 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ5, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It may associate with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Signalisation Notch