Bestrophin 3 anticorps (N-Term)

N° du produit ABIN633708

Détail du produit anti-Bestrophin 3 anticorps

Antigène: Bestrophin 3 (BEST3)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Bestrophin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: BEST3 antibody was raised against the N terminal of BEST3

Purification: Affinity purified

Immunogène: BEST3 antibody was raised using the N terminal of BEST3 corresponding to a region with amino acids PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BEST3 Blocking Peptide, catalog no. 33R-7214, is also available for use as a blocking control in assays to test for specificity of this BEST3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEST3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Bestrophin 3

Antigène: Bestrophin 3 (BEST3)

Autre désignation: BEST3 (BEST3 Produits)

Synonymes: anticorps CG12327, anticorps Dmel\\CG12327, anticorps dbest3, anticorps best-3, anticorps BEST3, anticorps VMD2L3, anticorps Vmd2l3, anticorps mBest4, anticorps bestrophin-3, anticorps bestrophin 3, anticorps Bestrophin 3, anticorps BEST3, anticorps Best3, anticorps best3

Sujet: BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy, and 2 other BEST1-like genes, BEST2 and BEST4.

Poids moléculaire: 51 kDa (MW of target protein)