MCOLN1 anticorps (N-Term)

N° du produit ABIN633712

Détail du produit anti-MCOLN1 anticorps

Antigène: MCOLN1 (Mucolipin 1 (MCOLN1))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCOLN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Mucolipin 1 antibody was raised against the N terminal of MCOLN1

Purification: Affinity purified

Immunogène: Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Mucolipin 1 Blocking Peptide, catalog no. 33R-3049, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCOLN1

Antigène: MCOLN1 (Mucolipin 1 (MCOLN1))

Autre désignation: Mucolipin 1 (MCOLN1 Produits)

Synonymes: anticorps mcoln1, anticorps mcoln1.1, anticorps zgc:63619, anticorps mln1, anticorps mucolipin-1, anticorps MCOLN1, anticorps MG-2, anticorps ML4, anticorps MLIV, anticorps MST080, anticorps TRP-ML1, anticorps TRPM-L1, anticorps TRPML1, anticorps 2210015I05Rik, anticorps mucolipidin, anticorps mucolipin 1a, anticorps mucolipin 1, anticorps mucolipin 1 L homeolog, anticorps mcoln1a, anticorps MCOLN1, anticorps mcoln1.L, anticorps mcoln1, anticorps LOAG_04987, anticorps Mcoln1

Sujet: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis