TRPM5 anticorps (N-Term)
-
- Antigène Voir toutes TRPM5 Anticorps
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRPM5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRPM5 antibody was raised against the N terminal of TRPM5
- Purification
- Affinity purified
- Immunogène
- TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
- Top Product
- Discover our top product TRPM5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRPM5 Blocking Peptide, catalog no. 33R-2505, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
- Autre désignation
- TRPM5 (TRPM5 Produits)
- Synonymes
- anticorps LTRPC5, anticorps MTR1, anticorps 9430099A16Rik, anticorps LTrpC-5, anticorps Ltrpc5, anticorps Mtr1, anticorps transient receptor potential cation channel subfamily M member 5, anticorps transient receptor potential cation channel, subfamily M, member 5, anticorps TRPM5, anticorps Trpm5, anticorps trpm5
- Sujet
- TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.
- Poids moléculaire
- 131 kDa (MW of target protein)
-