CLCNKA anticorps (N-Term)
-
- Antigène Voir toutes CLCNKA Anticorps
- CLCNKA (Chloride Channel Ka (CLCNKA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLCNKA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CLCNKA antibody was raised against the N terminal of CLCNKA
- Purification
- Affinity purified
- Immunogène
- CLCNKA antibody was raised using the N terminal of CLCNKA corresponding to a region with amino acids MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
- Top Product
- Discover our top product CLCNKA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLCNKA Blocking Peptide, catalog no. 33R-5907, is also available for use as a blocking control in assays to test for specificity of this CLCNKA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLCNKA (Chloride Channel Ka (CLCNKA))
- Autre désignation
- CLCNKA (CLCNKA Produits)
- Synonymes
- anticorps CLCNKA, anticorps C75963, anticorps CLC-K1, anticorps Clcnk1, anticorps CLCK1, anticorps ClC-K1, anticorps hClC-Ka, anticorps CLCNKB, anticorps chloride voltage-gated channel Ka, anticorps chloride channel protein ClC-Ka, anticorps chloride channel, voltage-sensitive Ka, anticorps CLCNKA, anticorps LOC703259, anticorps LOC100456543, anticorps LOC100593875, anticorps Clcnka
- Sujet
- CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 75 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-