TPCN1 anticorps (N-Term)

N° du produit ABIN633731

Détail du produit anti-TPCN1 anticorps

Antigène: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPCN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TPCN1 antibody was raised against the N terminal of TPCN1

Purification: Affinity purified

Immunogène: TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPCN1 Blocking Peptide, catalog no. 33R-10210, is also available for use as a blocking control in assays to test for specificity of this TPCN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPCN1

Antigène: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Autre désignation: TPCN1 (TPCN1 Produits)

Synonymes: anticorps ATCCH1, anticorps ATTPC1, anticorps CALCIUM CHANNEL 1, anticorps FATTY ACID OXYGENATION UPREGULATED 2, anticorps FOU2, anticorps T5L23.5, anticorps two-pore channel 1, anticorps 5730403B01Rik, anticorps Tpc1, anticorps mKIAA1169, anticorps TPC1, anticorps si:dkey-125i10.5, anticorps two pore segment channel 1, anticorps two-pore channel 1, anticorps two pore channel 1, anticorps Tpcn1, anticorps TPC1, anticorps TPCN1, anticorps tpcn1

Sujet: TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.

Poids moléculaire: 94 kDa (MW of target protein)