CHRNA4 anticorps (N-Term)
-
- Antigène Voir toutes CHRNA4 Anticorps
- CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHRNA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHRNA4 antibody was raised against the N terminal of CHRNA4
- Purification
- Affinity purified
- Immunogène
- CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
- Top Product
- Discover our top product CHRNA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHRNA4 Blocking Peptide, catalog no. 33R-1126, is also available for use as a blocking control in assays to test for specificity of this CHRNA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))
- Autre désignation
- CHRNA4 (CHRNA4 Produits)
- Synonymes
- anticorps NACHRA4, anticorps BFNC, anticorps EBN, anticorps EBN1, anticorps NACHR, anticorps NACRA4, anticorps NARAC, anticorps Acra-4, anticorps Acra4, anticorps ENFL1, anticorps neuronal acetylcholine receptor subunit alpha-4, anticorps neuronal acetylcholine receptor subunit alpha-4-like, anticorps cholinergic receptor nicotinic alpha 4 subunit, anticorps cholinergic receptor, nicotinic, alpha 4b, anticorps cholinergic receptor, nicotinic, alpha polypeptide 4, anticorps CpipJ_CPIJ002434, anticorps LOC100368057, anticorps CHRNA4, anticorps chrna4b, anticorps Chrna4
- Sujet
- CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-