CHRNA4 anticorps (N-Term)

N° du produit ABIN633758

Détail du produit anti-CHRNA4 anticorps

Antigène: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHRNA4 antibody was raised against the N terminal of CHRNA4

Purification: Affinity purified

Immunogène: CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHRNA4 Blocking Peptide, catalog no. 33R-1126, is also available for use as a blocking control in assays to test for specificity of this CHRNA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHRNA4

Antigène: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Autre désignation: CHRNA4 (CHRNA4 Produits)

Synonymes: anticorps NACHRA4, anticorps BFNC, anticorps EBN, anticorps EBN1, anticorps NACHR, anticorps NACRA4, anticorps NARAC, anticorps Acra-4, anticorps Acra4, anticorps ENFL1, anticorps neuronal acetylcholine receptor subunit alpha-4, anticorps neuronal acetylcholine receptor subunit alpha-4-like, anticorps cholinergic receptor nicotinic alpha 4 subunit, anticorps cholinergic receptor, nicotinic, alpha 4b, anticorps cholinergic receptor, nicotinic, alpha polypeptide 4, anticorps CpipJ_CPIJ002434, anticorps LOC100368057, anticorps CHRNA4, anticorps chrna4b, anticorps Chrna4

Sujet: CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Synaptic Membrane