GABRB2 anticorps
-
- Antigène Voir toutes GABRB2 Anticorps
- GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))
-
Reactivité
- Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GABRB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW
- Top Product
- Discover our top product GABRB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GABRB2 Blocking Peptide, catalog no. 33R-3806, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))
- Autre désignation
- GABRB2 (GABRB2 Produits)
- Sujet
- The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Synaptic Membrane
-