GABRB2 anticorps

N° du produit ABIN633763

Détail du produit anti-GABRB2 anticorps

Antigène: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reactivité: Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRB2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRB2 Blocking Peptide, catalog no. 33R-3806, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRB2

Antigène: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Autre désignation: GABRB2 (GABRB2 Produits)

Synonymes: anticorps GABRB2, anticorps GARB2, anticorps fj59e04, anticorps gabaabeta2, anticorps wu:fj59e04, anticorps zgc:136311, anticorps GABARB, anticorps AI834970, anticorps C030002O17Rik, anticorps C030021G16Rik, anticorps Gabrab2, anticorps Gabrb-2, anticorps gamma-aminobutyric acid type A receptor beta2 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, beta 2, anticorps gamma-aminobutyric acid type A receptor beta 2 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit beta 2, anticorps GABRB2, anticorps gabrb2, anticorps Gabrb2

Sujet: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane