KCNK4 anticorps (N-Term)

N° du produit ABIN633765

Détail du produit anti-KCNK4 anticorps

Antigène: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK4 antibody was raised against the N terminal of KCNK4

Purification: Affinity purified

Immunogène: KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK4 Blocking Peptide, catalog no. 33R-6385, is also available for use as a blocking control in assays to test for specificity of this KCNK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK4

Antigène: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Autre désignation: KCNK4 (KCNK4 Produits)

Synonymes: anticorps K2p4.1, anticorps TRAAK, anticorps TRAAK1, anticorps MLZ-622, anticorps TRAAKt, anticorps Tex40, anticorps KT4.1, anticorps potassium two pore domain channel subfamily K member 4, anticorps potassium channel, subfamily K, member 4, anticorps KCNK4, anticorps Kcnk4

Sujet: Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.

Poids moléculaire: 43 kDa (MW of target protein)