KCNK9 anticorps (N-Term)

N° du produit ABIN633772

Détail du produit anti-KCNK9 anticorps

Antigène: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK9 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK9 antibody was raised against the N terminal of KCNK9

Purification: Affinity purified

Immunogène: KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK9 Blocking Peptide, catalog no. 33R-7869, is also available for use as a blocking control in assays to test for specificity of this KCNK9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK9

Antigène: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Autre désignation: KCNK9 (KCNK9 Produits)

Synonymes: anticorps Task3, anticorps K2p9.1, anticorps KT3.2, anticorps TASK-3, anticorps TASK3, anticorps KCNK9, anticorps LOC799704, anticorps Kcnk9, anticorps task3, anticorps k2p9.1, anticorps task-3, anticorps kt3.2, anticorps potassium channel, subfamily K, member 9, anticorps potassium two pore domain channel subfamily K member 9, anticorps potassium channel, two pore domain subfamily K, member 9, anticorps potassium channel, two pore domain subfamily K, member 9 L homeolog, anticorps Kcnk9, anticorps KCNK9, anticorps kcnk9, anticorps kcnk9.L

Sujet: KCNK9 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate.

Poids moléculaire: 42 kDa (MW of target protein)