GRIK2 anticorps (C-Term)

N° du produit ABIN633773

Détail du produit anti-GRIK2 anticorps

Antigène: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRIK2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRIK2 antibody was raised against the C terminal of GRIK2

Purification: Affinity purified

Immunogène: GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

Information d'application

Indications d'application: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRIK2 Blocking Peptide, catalog no. 33R-8980, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRIK2

Antigène: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Autre désignation: GRIK2 (GRIK2 Produits)

Synonymes: anticorps GRIK5, anticorps eaa4, anticorps glr6, anticorps gluk6, anticorps glur6, anticorps grik2, anticorps mrt6, anticorps GluR6, anticorps grik2-A, anticorps EAA4, anticorps GLR6, anticorps GLUK6, anticorps GLUR6, anticorps GluK2, anticorps MRT6, anticorps AW124492, anticorps Glur-6, anticorps Glur6, anticorps Glurbeta2, anticorps GRIK2, anticorps glutamate ionotropic receptor kainate type subunit 2, anticorps glutamate receptor, ionotropic, kainate 2 L homeolog, anticorps glutamate receptor, ionotropic, kainate 2, anticorps glutamate receptor, ionotropic, kainate 2 (beta 2), anticorps GRIK2, anticorps grik2.L, anticorps grik2, anticorps Grik2

Sujet: This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity