ZACN anticorps (N-Term)

N° du produit ABIN633774

Détail du produit anti-ZACN anticorps

Antigène: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZACN est non-conjugé

Application: Western Blotting (WB)

Specificité: LGICZ1 antibody was raised against the N terminal Of Lgicz1

Purification: Affinity purified

Immunogène: LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGICZ1 Blocking Peptide, catalog no. 33R-7358, is also available for use as a blocking control in assays to test for specificity of this LGICZ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGICZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZACN

Antigène: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Autre désignation: LGICZ1 (ZACN Produits)

Synonymes: anticorps LGICZ1, anticorps L2, anticorps LGICZ, anticorps ZAC, anticorps ZAC1, anticorps zinc activated ion channel, anticorps ZACN

Sujet: LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Synaptic Membrane