GABRR2 anticorps

N° du produit ABIN633782

Détail du produit anti-GABRR2 anticorps

Antigène: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRR2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRR2 Blocking Peptide, catalog no. 33R-8654, is also available for use as a blocking control in assays to test for specificity of this GABRR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRR2

Antigène: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Autre désignation: GABRR2 (GABRR2 Produits)

Synonymes: anticorps si:dkey-181i3.1, anticorps gamma-aminobutyric acid type A receptor rho2 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, rho 2b, anticorps gamma-aminobutyric acid type A receptor rho 2 subunit, anticorps gamma-aminobutyric acid (GABA) C receptor, subunit rho 2, anticorps gamma-aminobutyric acid receptor subunit rho-2, anticorps GABRR2, anticorps gabrr2b, anticorps Gabrr2, anticorps LOC100653501

Sujet: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.

Poids moléculaire: 54 kDa (MW of target protein)