GABRQ anticorps

N° du produit ABIN633787

Détail du produit anti-GABRQ anticorps

Antigène: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRQ est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABRQ antibody was raised using a synthetic peptide corresponding to a region with amino acids KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRQ Blocking Peptide, catalog no. 33R-4370, is also available for use as a blocking control in assays to test for specificity of this GABRQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRQ

Antigène: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Autre désignation: GABRQ (GABRQ Produits)

Synonymes: anticorps THETA, anticorps gamma-aminobutyric acid type A receptor theta subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit theta, anticorps GABRQ, anticorps Gabrq

Sujet: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor.

Poids moléculaire: 72 kDa (MW of target protein)