KCNK1 anticorps (Middle Region)
-
- Antigène Voir toutes KCNK1 Anticorps
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNK1 antibody was raised against the middle region of KCNK1
- Purification
- Affinity purified
- Immunogène
- KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
- Top Product
- Discover our top product KCNK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))
- Autre désignation
- KCNK1 (KCNK1 Produits)
- Synonymes
- anticorps AI788889, anticorps TWIK-1, anticorps DPK, anticorps HOHO, anticorps K2P1, anticorps K2p1.1, anticorps KCNO1, anticorps TWIK1, anticorps Twik, anticorps k2p1.1, anticorps twik-1, anticorps twik1, anticorps rabKCNK1, anticorps im:7150627, anticorps kcnk1, anticorps zgc:165664, anticorps potassium channel, subfamily K, member 1, anticorps potassium two pore domain channel subfamily K member 1, anticorps potassium channel, two pore domain subfamily K, member 1 L homeolog, anticorps potassium channel, subfamily K, member 1a, anticorps Kcnk1, anticorps KCNK1, anticorps kcnk1.L, anticorps kcnk1a
- Sujet
- KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Poids moléculaire
- 38 kDa (MW of target protein)
-