GABRE anticorps
-
- Antigène Voir toutes GABRE Anticorps
- GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GABRE est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH
- Top Product
- Discover our top product GABRE Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GABRE Blocking Peptide, catalog no. 33R-2229, is also available for use as a blocking control in assays to test for specificity of this GABRE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))
- Autre désignation
- GABRE (GABRE Produits)
- Synonymes
- anticorps GABRE, anticorps gamma-aminobutyric acid type A receptor epsilon subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit epsilon, anticorps GABRE, anticorps Gabre
- Sujet
- GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-