GABRE anticorps

N° du produit ABIN633794

Détail du produit anti-GABRE anticorps

Antigène: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRE est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRE Blocking Peptide, catalog no. 33R-2229, is also available for use as a blocking control in assays to test for specificity of this GABRE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRE

Antigène: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Autre désignation: GABRE (GABRE Produits)

Synonymes: anticorps GABRE, anticorps gamma-aminobutyric acid type A receptor epsilon subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit epsilon, anticorps GABRE, anticorps Gabre

Sujet: GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane