NR2E1 anticorps (Middle Region)
-
- Antigène Voir toutes NR2E1 Anticorps
- NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NR2E1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NR2 E1 antibody was raised against the middle region of NR2 1
- Purification
- Affinity purified
- Immunogène
- NR2 E1 antibody was raised using the middle region of NR2 1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL
- Top Product
- Discover our top product NR2E1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))
- Autre désignation
- NR2E1 (NR2E1 Produits)
- Synonymes
- anticorps NR2E1, anticorps TLL, anticorps TLX, anticorps XTLL, anticorps Mtl1, anticorps Mtll, anticorps Tlx, anticorps fierce, anticorps frc, anticorps tailless, anticorps fc30e03, anticorps fc39f12, anticorps wu:fc30e03, anticorps wu:fc39f12, anticorps zgc:100991, anticorps Xtll, anticorps nr2e1-A, anticorps tlx, anticorps nuclear receptor subfamily 2 group E member 1, anticorps nuclear receptor subfamily 2, group E, member 1, anticorps nuclear receptor subfamily 2 group E member 1 S homeolog, anticorps NR2E1, anticorps Nr2e1, anticorps nr2e1, anticorps nr2e1.S
- Sujet
- The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Stem Cell Maintenance
-