MTR anticorps (C-Term)

N° du produit ABIN633804

Détail du produit anti-MTR anticorps

Antigène: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTR est non-conjugé

Application: Western Blotting (WB)

Specificité: MTR antibody was raised against the C terminal of MTR

Réactivité croisée: Humain

Purification: Affinity purified

Immunogène: MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTR Blocking Peptide, catalog no. 33R-3557, is also available for use as a blocking control in assays to test for specificity of this MTR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTR

Antigène: MTR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase (MTR))

Autre désignation: MTR (MTR Produits)

Synonymes: anticorps HMAG, anticorps MS, anticorps cblG, anticorps AI894170, anticorps D830038K18Rik, anticorps methioninesynthase, anticorps 5-methyltetrahydrofolate-homocysteine methyltransferase, anticorps MTR, anticorps Mtr

Sujet: MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.

Poids moléculaire: 140 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process