DPYSL3 anticorps (Middle Region)
-
- Antigène Voir toutes DPYSL3 Anticorps
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPYSL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DPYSL3 antibody was raised against the middle region of DPYSL3
- Purification
- Affinity purified
- Immunogène
- DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
- Top Product
- Discover our top product DPYSL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
- Autre désignation
- DPYSL3 (DPYSL3 Produits)
- Synonymes
- anticorps CRMP4A, anticorps CRMP4B, anticorps dpysl3, anticorps DRP-3, anticorps MGC69487, anticorps dpysl3-b, anticorps crmp4, anticorps CRMP-4, anticorps xCRMP4, anticorps DRP-3-B, anticorps DPYSL3, anticorps CRMP4, anticorps DRP3, anticorps LCRMP, anticorps ULIP, anticorps ULIP-1, anticorps TUC4, anticorps Ulip, anticorps Ulip1, anticorps Crmp4, anticorps TUC-4b, anticorps drp-3, anticorps drp3, anticorps lcrmp, anticorps nsp1, anticorps tuc-4, anticorps tuc4, anticorps ulip, anticorps ulip-1, anticorps dihydropyrimidinase like 3, anticorps dihydropyrimidinase like 3 L homeolog, anticorps dihydropyrimidinase-like 3, anticorps dihydropyrimidinase like 3 S homeolog, anticorps DPYSL3, anticorps dpysl3, anticorps dpysl3.L, anticorps Dpysl3, anticorps dpysl3.S
- Sujet
- DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
- Poids moléculaire
- 62 kDa (MW of target protein)
-