HEY1 anticorps (N-Term)
-
- Antigène Voir toutes HEY1 Anticorps
- HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HEY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HEY1 antibody was raised against the N terminal of HEY1
- Purification
- Affinity purified
- Immunogène
- HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG
- Top Product
- Discover our top product HEY1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HEY1 Blocking Peptide, catalog no. 33R-1335, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))
- Autre désignation
- HEY1 (HEY1 Produits)
- Synonymes
- anticorps BHLHb31, anticorps CHF2, anticorps HERP2, anticorps HESR1, anticorps HRT-1, anticorps OAF1, anticorps AI316788, anticorps AI414254, anticorps HRT1, anticorps Herp2, anticorps Hesr1, anticorps bHLHb31, anticorps hesr-1, anticorps id:ibd1292, anticorps zgc:110572, anticorps bc8, anticorps chf2, anticorps herp2, anticorps hesr1, anticorps hrt1, anticorps oaf1, anticorps xbc8, anticorps hes related family bHLH transcription factor with YRPW motif 1, anticorps hairy/enhancer-of-split related with YRPW motif 1, anticorps hes-related family bHLH transcription factor with YRPW motif 1, anticorps hes related family bHLH transcription factor with YRPW motif 1 S homeolog, anticorps HEY1, anticorps Hey1, anticorps hey1, anticorps hey1.S
- Sujet
- Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- Tube Formation
-