ube3a anticorps (Middle Region)
-
- Antigène Voir toutes ube3a Anticorps
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ube3a est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UBE3 A antibody was raised against the middle region of Ube3
- Purification
- Affinity purified
- Immunogène
- UBE3 A antibody was raised using the middle region of Ube3 corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
- Top Product
- Discover our top product ube3a Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE3A Blocking Peptide, catalog no. 33R-1304, is also available for use as a blocking control in assays to test for specificity of this UBE3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ube3a (Ubiquitin Protein Ligase E3A (ube3a))
- Autre désignation
- UBE3A (ube3a Produits)
- Synonymes
- anticorps ANCR, anticorps AS, anticorps E6-AP, anticorps EPVE6AP, anticorps HPVE6A, anticorps DDBDRAFT_0188760, anticorps DDBDRAFT_0302447, anticorps DDB_0188760, anticorps DDB_0302447, anticorps ube3a, anticorps im:7140733, anticorps zgc:92173, anticorps 4732496B02, anticorps 5830462N02Rik, anticorps A130086L21Rik, anticorps Hpve6a, anticorps mKIAA4216, anticorps As, anticorps CG6190, anticorps Dmel\\CG6190, anticorps Dube3a, anticorps UBE3A, anticorps dUBE3A, anticorps das, anticorps dube3A, anticorps dube3a, anticorps MGC69536, anticorps UME3A, anticorps ubiquitin protein ligase E3A, anticorps ubiquitin-protein ligase E3A, anticorps Ubiquitin protein ligase E3A, anticorps ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) S homeolog, anticorps ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome), anticorps UBE3A, anticorps ube3a, anticorps LOC100194730, anticorps Ube3a, anticorps ube3a.S, anticorps Eint_040430
- Sujet
- UBE3A is an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53.
- Poids moléculaire
- 101 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway
-