CRMP1 anticorps (C-Term)

N° du produit ABIN633822

Détail du produit anti-CRMP1 anticorps

Antigène: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRMP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CRMP1 antibody was raised against the C terminal of CRMP1

Purification: Affinity purified

Immunogène: CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRMP1 Blocking Peptide, catalog no. 33R-8838, is also available for use as a blocking control in assays to test for specificity of this CRMP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRMP1

Antigène: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Autre désignation: CRMP1 (CRMP1 Produits)

Synonymes: anticorps CRMP1, anticorps crmp1, anticorps MGC145930, anticorps CRMP 1, anticorps CRMP-1, anticorps PCRMP 1, anticorps PCRMP-1, anticorps PCRMP1, anticorps PfCRMP-1, anticorps DPYSL1, anticorps DRP-1, anticorps DRP1, anticorps ULIP-3, anticorps Dpysl1, anticorps Ulip3, anticorps CRMP1B, anticorps collapsin response mediator protein 1, anticorps dihydropyrimidinase-related protein 1, anticorps cysteine repeat modular protein 1, putative, anticorps collapsin response mediator protein 1 L homeolog, anticorps CRMP1, anticorps crmp1, anticorps LOC100350067, anticorps PfCRMP1, anticorps Crmp1, anticorps crmp1.L

Sujet: CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.

Poids moléculaire: 62 kDa (MW of target protein)