MPPED2 anticorps (C-Term)
-
- Antigène Voir toutes MPPED2 Anticorps
- MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPPED2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MPPED2 antibody was raised against the C terminal of MPPED2
- Purification
- Affinity purified
- Immunogène
- MPPED2 antibody was raised using the C terminal of MPPED2 corresponding to a region with amino acids PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
- Top Product
- Discover our top product MPPED2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPPED2 Blocking Peptide, catalog no. 33R-7172, is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))
- Autre désignation
- MPPED2 (MPPED2 Produits)
- Synonymes
- anticorps 239fb, anticorps 239FB, anticorps C11orf8, anticorps 239Fb, anticorps 2700082O15Rik, anticorps AV354767, anticorps AW060960, anticorps C11orf8h, anticorps brpl, anticorps cb1097, anticorps fk34e08, anticorps wu:fk34e08, anticorps zgc:56667, anticorps metallophosphoesterase domain containing 2 S homeolog, anticorps metallophosphoesterase domain containing 2, anticorps metallophosphoesterase domain containing 2b, anticorps mpped2.S, anticorps MPPED2, anticorps Mpped2, anticorps mpped2
- Sujet
- MPPED2 protein displays low level metallophosphoesterase activity.
- Poids moléculaire
- 33 kDa (MW of target protein)
-