Cardiotrophin 1 anticorps (N-Term)
-
- Antigène Voir toutes Cardiotrophin 1 (CTF1) Anticorps
- Cardiotrophin 1 (CTF1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cardiotrophin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cardiotrophin 1 antibody was raised against the N terminal of CTF1
- Purification
- Affinity purified
- Immunogène
- Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
- Top Product
- Discover our top product CTF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cardiotrophin 1 Blocking Peptide, catalog no. 33R-6489, is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cardiotrophin 1 (CTF1)
- Autre désignation
- Cardiotrophin 1 (CTF1 Produits)
- Synonymes
- anticorps CTF1, anticorps ct1, anticorps ct-1, anticorps ctf2, anticorps CT-1, anticorps CT1, anticorps cardiotrophin 1, anticorps cardiotrophin-1, anticorps CTF1, anticorps ctf1, anticorps Ctf1, anticorps LOC100736818
- Sujet
- CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT
-