PHYH anticorps (Middle Region)
-
- Antigène Voir toutes PHYH Anticorps
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PHYH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PHYH antibody was raised against the middle region of PHYH
- Purification
- Affinity purified
- Immunogène
- PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI
- Top Product
- Discover our top product PHYH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PHYH Blocking Peptide, catalog no. 33R-2503, is also available for use as a blocking control in assays to test for specificity of this PHYH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
- Autre désignation
- PHYH (PHYH Produits)
- Synonymes
- anticorps zgc:110203, anticorps LN1, anticorps LNAP1, anticorps PAHX, anticorps PHYH1, anticorps RD, anticorps AI256161, anticorps AI265699, anticorps Lnap1, anticorps phytanoyl-CoA 2-hydroxylase, anticorps phytanoyl-CoA hydroxylase-like, anticorps phytanoyl-CoA hydroxylase, anticorps PHYH, anticorps LOC478001, anticorps phyh, anticorps Phyh
- Sujet
- This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-