CHERP anticorps (Middle Region)

N° du produit ABIN633834

Détail du produit anti-CHERP anticorps

Antigène: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHERP est non-conjugé

Application: Western Blotting (WB)

Specificité: CHERP antibody was raised against the middle region of CHERP

Purification: Affinity purified

Immunogène: CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHERP

Antigène: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Autre désignation: CHERP (CHERP Produits)

Synonymes: anticorps cherp, anticorps MGC53695, anticorps CHERP, anticorps DAN16, anticorps SCAF6, anticorps SRA1, anticorps ik:tdsubc_2h12, anticorps scaf6, anticorps wu:fc83d01, anticorps xx:tdsubc_2h12, anticorps zgc:55518, anticorps 5730408I11Rik, anticorps D8Wsu96e, anticorps Scaf6, anticorps calcium homeostasis endoplasmic reticulum protein S homeolog, anticorps calcium homeostasis endoplasmic reticulum protein, anticorps calcium homeostasis endoplasmic reticulum protein L homeolog, anticorps cherp.S, anticorps CHERP, anticorps cherp, anticorps Tsp_15667, anticorps cherp.L, anticorps Cherp

Sujet: CHERP is involved in calcium homeostasis, growth and proliferation.

Poids moléculaire: 104 kDa (MW of target protein)