SNCA anticorps

N° du produit ABIN633838

Détail du produit anti-SNCA anticorps

Antigène: SNCA (Synuclein, alpha (SNCA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNCA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Synuclein Alpha Blocking Peptide, catalog no. 33R-9853, is also available for use as a blocking control in assays to test for specificity of this Synuclein Alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNCA

Antigène: SNCA (Synuclein, alpha (SNCA))

Autre désignation: Synuclein alpha (SNCA Produits)

Synonymes: anticorps snca, anticorps MGC64356, anticorps LOC619283, anticorps NACP, anticorps alphaSYN, anticorps PARK1, anticorps PARK4, anticorps PD1, anticorps synuclein alpha L homeolog, anticorps alpha-synuclein, anticorps synuclein alpha, anticorps synuclein, alpha, anticorps snca.L, anticorps LOC619283, anticorps SNCA, anticorps Snca

Sujet: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Negative Regulation of Transporter Activity, Regulation of long-term Neuronal Synaptic Plasticity