Glutathione Reductase anticorps (N-Term)

N° du produit ABIN633841

Détail du produit anti-Glutathione Reductase anticorps

Antigène: Glutathione Reductase (GSR)

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glutathione Reductase est non-conjugé

Application: Western Blotting (WB)

Specificité: GSR antibody was raised against the N terminal of GSR

Purification: Affinity purified

Immunogène: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSR Blocking Peptide, catalog no. 33R-7387, is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glutathione Reductase

Antigène: Glutathione Reductase (GSR)

Autre désignation: GSR (GSR Produits)

Synonymes: anticorps GR, anticorps ATGR2, anticorps EMB2360, anticorps glutathione reductase, anticorps AI325518, anticorps D8Ertd238e, anticorps Gr-1, anticorps Gr1, anticorps DDBDRAFT_0168952, anticorps DDBDRAFT_0231410, anticorps DDB_0168952, anticorps DDB_0231410, anticorps 2151, anticorps CG2151, anticorps DTR, anticorps Dm-TrxR, anticorps DmTR, anticorps DmTrx, anticorps DmTrxR, anticorps DmTrxR-1, anticorps Dmel\\CG2151, anticorps Gr, anticorps Trx, anticorps TrxR, anticorps TrxR-1, anticorps Trxr1, anticorps anon-WO03040301.185, anticorps anon-WO03040301.187, anticorps dTrxR, anticorps dmtrxr-1, anticorps gr, anticorps l(1)G0154, anticorps l(1)G0379, anticorps l(1)G0477, anticorps l(1)G0481, anticorps trxr-1, anticorps gor1, anticorps glutathione reductase, gro-2, anticorps glutathione reductase, anticorps glutathione-disulfide reductase, anticorps GR; GRase, anticorps mitochondrial glutathione reductase Pgr1, anticorps Glutathione reductase (GR) (GRase), anticorps Thioredoxin reductase-1, anticorps glutathione-disulfide reductase family protein, anticorps glutathione reductase 1, anticorps GR, anticorps gor, anticorps GSR, anticorps GSR1, anticorps Gsr_2, anticorps Gsr, anticorps GSHR1, anticorps gsr, anticorps LbGR, anticorps pgr1, anticorps GSHR2, anticorps GLR2, anticorps Bcen_2392, anticorps RPE_1989, anticorps HCAG_02219, anticorps SJAG_01162, anticorps Trxr-1, anticorps PF14_0192, anticorps POPTR_0001s14480g, anticorps gsr1

Sujet: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis