ECHDC2 anticorps (Middle Region)
-
- Antigène Tous les produits ECHDC2
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ECHDC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ECHDC2 antibody was raised against the middle region of ECHDC2
- Purification
- Affinity purified
- Immunogène
- ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ECHDC2 Blocking Peptide, catalog no. 33R-3118, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
- Autre désignation
- ECHDC2 (ECHDC2 Produits)
- Synonymes
- anticorps NV16396, anticorps id:ibd1032, anticorps wu:fc83b02, anticorps zgc:56321, anticorps zgc:85763, anticorps RGD1308525, anticorps 1300017C12Rik, anticorps 2610009M20Rik, anticorps D4Ertd765e, anticorps enoyl-CoA hydratase domain containing 2, anticorps methylglutaconyl-CoA hydratase, mitochondrial, anticorps enoyl CoA hydratase domain containing 2, anticorps enoyl Coenzyme A hydratase domain containing 2, anticorps ECHDC2, anticorps echdc2, anticorps LOC100121877, anticorps Echdc2
- Sujet
- ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.
- Poids moléculaire
- 28 kDa (MW of target protein)
-