ECHDC2 anticorps (Middle Region)

N° du produit ABIN633843

Détail du produit anti-ECHDC2 anticorps

Antigène: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHDC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ECHDC2 antibody was raised against the middle region of ECHDC2

Purification: Affinity purified

Immunogène: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHDC2 Blocking Peptide, catalog no. 33R-3118, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHDC2

Antigène: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Autre désignation: ECHDC2 (ECHDC2 Produits)

Synonymes: anticorps NV16396, anticorps id:ibd1032, anticorps wu:fc83b02, anticorps zgc:56321, anticorps zgc:85763, anticorps RGD1308525, anticorps 1300017C12Rik, anticorps 2610009M20Rik, anticorps D4Ertd765e, anticorps enoyl-CoA hydratase domain containing 2, anticorps methylglutaconyl-CoA hydratase, mitochondrial, anticorps enoyl CoA hydratase domain containing 2, anticorps enoyl Coenzyme A hydratase domain containing 2, anticorps ECHDC2, anticorps echdc2, anticorps LOC100121877, anticorps Echdc2

Sujet: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Poids moléculaire: 28 kDa (MW of target protein)