PLA2G5 anticorps (N-Term)

N° du produit ABIN633845

Détail du produit anti-PLA2G5 anticorps

Antigène: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLA2G5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLA2 G5 antibody was raised against the N terminal of PLA2 5

Purification: Affinity purified

Immunogène: PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLA2G5 Blocking Peptide, catalog no. 33R-6140, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLA2G5

Antigène: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Autre désignation: PLA2G5 (PLA2G5 Produits)

Synonymes: anticorps PLA2, anticorps sPLA2, anticorps FRFB, anticorps GV-PLA2, anticorps PLA2-10, anticorps hVPLA(2), anticorps phospholipase A2 group V, anticorps phospholipase A2, group V, anticorps PLA2G5, anticorps Pla2g5

Sujet: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Inositol Metabolic Process