PGS1 anticorps (C-Term)

N° du produit ABIN633847

Détail du produit anti-PGS1 anticorps

Antigène: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PGS1 antibody was raised against the C terminal of PGS1

Purification: Affinity purified

Immunogène: PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGS1 Blocking Peptide, catalog no. 33R-7584, is also available for use as a blocking control in assays to test for specificity of this PGS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGS1

Antigène: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Autre désignation: PGS1 (PGS1 Produits)

Synonymes: anticorps 2610019F11Rik, anticorps 4933424M23Rik, anticorps SAF, anticorps RGD1305052, anticorps phosphatidylglycerophosphate synthase 1, anticorps phosphatidylglycerophosphate synthase 1 S homeolog, anticorps PGS1, anticorps Pgs1, anticorps pgs1.S, anticorps pgs1

Sujet: PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.

Poids moléculaire: 63 kDa (MW of target protein)