HS2ST1 anticorps (Middle Region)

N° du produit ABIN633850

Détail du produit anti-HS2ST1 anticorps

Antigène: HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS2ST1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HS2 ST1 antibody was raised against the middle region of HS2 T1

Purification: Affinity purified

Immunogène: HS2 ST1 antibody was raised using the middle region of HS2 T1 corresponding to a region with amino acids GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS2ST1 Blocking Peptide, catalog no. 33R-3656, is also available for use as a blocking control in assays to test for specificity of this HS2ST1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS2ST1

Antigène: HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))

Autre désignation: HS2ST1 (HS2ST1 Produits)

Synonymes: anticorps HS2ST1, anticorps hs2st, anticorps dJ604K5.2, anticorps AW214369, anticorps Hs2st, anticorps mKIAA0448, anticorps CHS2ST, anticorps HS2ST, anticorps 2-OST, anticorps 2OST, anticorps HS2st, anticorps hs2st1, anticorps im:7147474, anticorps zgc:158230, anticorps heparan sulfate 2-O-sulfotransferase 1, anticorps Heparan sulfate 2-O-sulfotransferase 1, anticorps heparan sulfate 2-O-sulfotransferase 1 L homeolog, anticorps heparan sulfate 2-O-sulfotransferase 1a, anticorps HS2ST1, anticorps Tsp_05909, anticorps hs2st1, anticorps hs2st, anticorps Hs2st1, anticorps hs2st1.L, anticorps hs2st1a

Sujet: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Tube Formation, SARS-CoV-2 Protein Interactome