SDF2 anticorps (Middle Region)
-
- Antigène Voir toutes SDF2 Anticorps
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SDF2 antibody was raised against the middle region of SDF2
- Purification
- Affinity purified
- Immunogène
- SDF2 antibody was raised using the middle region of SDF2 corresponding to a region with amino acids RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG
- Top Product
- Discover our top product SDF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDF2 Blocking Peptide, catalog no. 33R-7844, is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
- Autre désignation
- SDF2 (SDF2 Produits)
- Synonymes
- anticorps AI853825, anticorps fk23f01, anticorps wu:fk23f01, anticorps zgc:66291, anticorps stromal cell derived factor 2, anticorps stromal cell-derived factor 2, anticorps stromal cell derived factor 2 L homeolog, anticorps sdf2, anticorps Sdf2, anticorps sdf2.L, anticorps SDF2
- Sujet
- SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-