MST1 anticorps
-
- Antigène Voir toutes MST1 Anticorps
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MST1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
- Top Product
- Discover our top product MST1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))
- Autre désignation
- MST1 (MST1 Produits)
- Synonymes
- anticorps D3F15S2, anticorps DNF15S2, anticorps HGFL, anticorps MSP, anticorps NF15S2, anticorps E2F2, anticorps D3F15S2h, anticorps D9H3F15S2, anticorps DNF15S2h, anticorps Hgfl, anticorps HGF1/MSP, anticorps E1A, anticorps XHL, anticorps d3f15s2, anticorps dnf15s2, anticorps hgfl, anticorps msp, anticorps mst1, anticorps nf15s2, anticorps macrophage stimulating 1, anticorps macrophage stimulating 1 (hepatocyte growth factor-like), anticorps serine/threonine kinase 4, anticorps macrophage stimulating 1 L homeolog, anticorps MST1, anticorps Mst1, anticorps STK4, anticorps mst1.L
- Sujet
- MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
- Poids moléculaire
- 80 kDa (MW of target protein)
-