OPTC anticorps (C-Term)

N° du produit ABIN633856

Détail du produit anti-OPTC anticorps

Antigène: OPTC (Opticin (OPTC))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OPTC est non-conjugé

Application: Western Blotting (WB)

Specificité: Opticin antibody was raised against the C terminal of OPTC

Purification: Affinity purified

Immunogène: Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Opticin Blocking Peptide, catalog no. 33R-5414, is also available for use as a blocking control in assays to test for specificity of this Opticin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OPTC

Antigène: OPTC (Opticin (OPTC))

Autre désignation: Opticin (OPTC Produits)

Synonymes: anticorps OPTC, anticorps optc, anticorps OPT, anticorps SLRP, anticorps dspg3, anticorps optcl, anticorps wu:fb81a05, anticorps zgc:101047, anticorps opticin, anticorps OPTC, anticorps optc, anticorps Optc

Sujet: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization.

Poids moléculaire: 35 kDa (MW of target protein)