Arylsulfatase A anticorps (N-Term)

N° du produit ABIN633858

Détail du produit anti-Arylsulfatase A anticorps

Antigène: Arylsulfatase A (ARSA)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Arylsulfatase A est non-conjugé

Application: Western Blotting (WB)

Specificité: ARSA antibody was raised against the N terminal of ARSA

Purification: Affinity purified

Immunogène: ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARSA Blocking Peptide, catalog no. 33R-2042, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Arylsulfatase A

Antigène: Arylsulfatase A (ARSA)

Autre désignation: ARSA (ARSA Produits)

Synonymes: anticorps ARSA, anticorps zgc:101575, anticorps arsa, anticorps AS-A, anticorps ASA, anticorps AW212749, anticorps As-2, anticorps As2, anticorps TISP73, anticorps MLD, anticorps mld, anticorps arylsulfatase A, anticorps arylsulfatase, anticorps arylsulfatase A, gene 1 S homeolog, anticorps ARSA, anticorps arsa, anticorps arsA, anticorps RB6599, anticorps Arsa, anticorps arsa.1.S

Sujet: The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Poids moléculaire: 56 kDa (MW of target protein)