NOMO1 anticorps (C-Term)

N° du produit ABIN633864

Détail du produit anti-NOMO1 anticorps

Antigène: NOMO1 (NODAL Modulator 1 (NOMO1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOMO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NOMO1 antibody was raised against the C terminal of NOMO1

Purification: Affinity purified

Immunogène: NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOMO1 Blocking Peptide, catalog no. 33R-7500, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOMO1

Antigène: NOMO1 (NODAL Modulator 1 (NOMO1))

Autre désignation: NOMO1 (NOMO1 Produits)

Synonymes: anticorps Nomo, anticorps PM5, anticorps D7Ertd156e, anticorps pM5, anticorps RGD1305240, anticorps NOMO2, anticorps DKFZP459L1733, anticorps Nomo1, anticorps NODAL modulator 1, anticorps nodal modulator 1, anticorps NOMO1, anticorps Nomo1, anticorps LOC515570, anticorps LOC714226, anticorps LOC100025365, anticorps LOC100174326, anticorps LOC100408200, anticorps LOC100464689, anticorps LOC100544619, anticorps LOC100626015, anticorps LOC454345, anticorps LOC489992, anticorps LOC100713781

Sujet: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Poids moléculaire: 134 kDa (MW of target protein)