FKBP2 anticorps (N-Term)

N° du produit ABIN633871

Détail du produit anti-FKBP2 anticorps

Antigène: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FKBP2 antibody was raised against the N terminal of FKBP2

Purification: Affinity purified

Immunogène: FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP2 Blocking Peptide, catalog no. 33R-8052, is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP2

Antigène: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Autre désignation: FKBP2 (FKBP2 Produits)

Synonymes: anticorps FKBP-13, anticorps PPIase, anticorps FKBP12, anticorps Fkbp2, anticorps 13kDa, anticorps FKBP-2, anticorps mFKBP13, anticorps mFKBP2, anticorps RGD1560660, anticorps zgc:101826, anticorps FK506 binding protein 2, anticorps FK506 binding protein 1a, anticorps FK506 binding protein 2 L homeolog, anticorps FKBP2, anticorps Fkbp1a, anticorps Fkbp2, anticorps fkbp2, anticorps fkbp2.L

Sujet: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Poids moléculaire: 16 kDa (MW of target protein)