CBLN4 anticorps (C-Term)

N° du produit ABIN633873

Détail du produit anti-CBLN4 anticorps

Antigène: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBLN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CBLN4 antibody was raised against the C terminal of CBLN4

Purification: Affinity purified

Immunogène: CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CBLN4 Blocking Peptide, catalog no. 33R-3868, is also available for use as a blocking control in assays to test for specificity of this CBLN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBLN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CBLN4

Antigène: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Autre désignation: CBLN4 (CBLN4 Produits)

Sujet: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.

Poids moléculaire: 22 kDa (MW of target protein)