AGXT2 anticorps (N-Term)

N° du produit ABIN633875

Détail du produit anti-AGXT2 anticorps

Antigène: AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGXT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AGXT2 antibody was raised against the N terminal of AGXT2

Purification: Affinity purified

Immunogène: AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGXT2 Blocking Peptide, catalog no. 33R-9305, is also available for use as a blocking control in assays to test for specificity of this AGXT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGXT2

Antigène: AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))

Autre désignation: AGXT2 (AGXT2 Produits)

Synonymes: anticorps AGT2, anticorps DAIBAT, anticorps AI303810, anticorps AI663818, anticorps T19P19.50, anticorps T19P19_50, anticorps alanine:glyoxylate aminotransferase 2, anticorps im:7153274, anticorps zgc:114195, anticorps alanine--glyoxylate aminotransferase 2, anticorps alanine-glyoxylate aminotransferase 2, anticorps alanine:glyoxylate aminotransferase 2, anticorps AGXT2, anticorps Agxt2, anticorps AGT2, anticorps agxt2

Sujet: The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process