GPX3 anticorps

N° du produit ABIN633878

Détail du produit anti-GPX3 anticorps

Antigène: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPX3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPX3 Blocking Peptide, catalog no. 33R-1870, is also available for use as a blocking control in assays to test for specificity of this GPX3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPX3

Antigène: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Autre désignation: GPX3 (GPX3 Produits)

Synonymes: anticorps GPX3, anticorps DKFZp469D1932, anticorps AA960521, anticorps EGPx, anticorps GPx, anticorps GSHPx-3, anticorps GSHPx-P, anticorps GPx-3, anticorps GPx-P, anticorps Gpxp, anticorps glutathione peroxidase 3, anticorps gpx3, anticorps GPX3, anticorps Gpx3

Sujet: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis