CRISP1 anticorps (N-Term)
-
- Antigène Voir toutes CRISP1 Anticorps
- CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRISP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRISP1 antibody was raised against the N terminal of CRISP1
- Purification
- Affinity purified
- Immunogène
- CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW
- Top Product
- Discover our top product CRISP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRISP1 Blocking Peptide, catalog no. 33R-5093, is also available for use as a blocking control in assays to test for specificity of this CRISP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))
- Autre désignation
- CRISP1 (CRISP1 Produits)
- Sujet
- Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.
- Poids moléculaire
- 27 kDa (MW of target protein)
-